PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10431212g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 284aa    MW: 31715.6 Da    PI: 5.3802
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10431212g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-151764148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEd +l+ +++  G g+W++ +++ g+ R++k+c++rw +yl
  MA_10431212g0010 17 RGFWSPEEDMKLISYIATNGHGCWSSLSERAGLQRCGKSCRLRWMNYL 64
                      799*******************************************97 PP

2Myb_DNA-binding45.61.7e-1470113146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++teE+  ++ + ++l ++ W+ Ia++++ gRt+ ++k++w++
  MA_10431212g0010  70 RGNFSTEEENAIISLQARLNNR-WAQIAKHLP-GRTDTEIKNYWHS 113
                       89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-23967IPR009057Homeodomain-like
PROSITE profilePS5129415.681264IPR017930Myb domain
SuperFamilySSF466898.79E-2815111IPR009057Homeodomain-like
SMARTSM007171.9E-121666IPR001005SANT/Myb domain
PfamPF002492.1E-141764IPR001005SANT/Myb domain
CDDcd001677.66E-112064No hitNo description
PROSITE profilePS5129423.25965119IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2368118IPR009057Homeodomain-like
SMARTSM007171.4E-1369117IPR001005SANT/Myb domain
PfamPF002497.6E-1370114IPR001005SANT/Myb domain
CDDcd001674.85E-1072112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MKHHVVHNCC SKKAVKRGFW SPEEDMKLIS YIATNGHGCW SSLSERAGLQ RCGKSCRLRW  60
MNYLRPGIKR GNFSTEEENA IISLQARLNN RWAQIAKHLP GRTDTEIKNY WHSCLKKKAV  120
AAGAANQGVC EAPTMILDPI DIDVIDMDPA PEIDLYGDSG AGCSRFEVIL SPSITPEVTD  180
WGNFEQNCDQ FSANGSSVYK ETLNDDDRYG DVSLDFPLVG DRNSCCSTTV RNQNWQPVDS  240
NCVSFSPSSC SLLNQKNPDE TLFEQIQAAL IMLSEDFGSE LRPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231711927128MYB TRANSFORMING PROTEIN
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1174390.0BT117439.1 Picea glauca clone GQ03819_I19 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.21e-55myb domain protein 26